- Recombinant Chlamydomonas reinhardtii Cytochrome b6-f complex subunit 8, chloroplastic (PETN)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1070248
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 3,727 Da
- E Coli or Yeast
- 12785
- Cytochrome b6-f complex subunit 8, chloroplastic (PETN)
Sequence
MLAEGEPAIVQIGWAATCVMFSFSLSLVVWGRSGL